SLC2A3,GLUT3
  • SLC2A3,GLUT3

Anti-SLC2A3 Antibody 25ul

Ref: AN-HPA006539-25ul
Anti-SLC2A3

Información del producto

Polyclonal Antibody against Human SLC2A3, Gene description: solute carrier family 2 (facilitated glucose transporter), member 3, Alternative Gene Names: GLUT3, Validated applications: ICC, IHC, Uniprot ID: P11169, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SLC2A3
Gene Description solute carrier family 2 (facilitated glucose transporter), member 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence KVPETRGRTFEDITRAFEGQAHGADRSGKDGVMEMNSIEPAKETTT
Immunogen KVPETRGRTFEDITRAFEGQAHGADRSGKDGVMEMNSIEPAKETTT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GLUT3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P11169
HTS Code 3002150000
Gene ID 6515
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SLC2A3 Antibody 25ul

Anti-SLC2A3 Antibody 25ul