S100A1,S100-alpha
  • S100A1,S100-alpha

Anti-S100A1 Antibody 100ul

Ref: AN-HPA006462-100ul
Anti-S100A1

Información del producto

Polyclonal Antibody against Human S100A1, Gene description: S100 calcium binding protein A1, Alternative Gene Names: S100-alpha, S100A, Validated applications: IHC, WB, Uniprot ID: P23297, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name S100A1
Gene Description S100 calcium binding protein A1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
Immunogen GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names S100-alpha, S100A
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P23297
HTS Code 3002150000
Gene ID 6271
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-S100A1 Antibody 100ul

Anti-S100A1 Antibody 100ul