MYRIP,DKFZp586F1018
  • MYRIP,DKFZp586F1018

Anti-MYRIP Antibody 100ul

Ref: AN-HPA006433-100ul
Anti-MYRIP

Información del producto

Polyclonal Antibody against Human MYRIP, Gene description: myosin VIIA and Rab interacting protein, Alternative Gene Names: DKFZp586F1018, exophilin-8, MyRIP, SLAC2-C, SLAC2C, Validated applications: ICC, Uniprot ID: Q8NFW9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MYRIP
Gene Description myosin VIIA and Rab interacting protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence SALPSWKSVDRLDETNLAPVLQSPDGNWVALKDGAPPPTRLLAKPKSGTFQALEVASSVASAYDEMGSDSEEDFDWSEALSKLCPRSRALPRNPQPQPTQAQSSDQGPIAASPSSALSPNPEAMCSDSETSSAGSSR
Immunogen SALPSWKSVDRLDETNLAPVLQSPDGNWVALKDGAPPPTRLLAKPKSGTFQALEVASSVASAYDEMGSDSEEDFDWSEALSKLCPRSRALPRNPQPQPTQAQSSDQGPIAASPSSALSPNPEAMCSDSETSSAGSSR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp586F1018, exophilin-8, MyRIP, SLAC2-C, SLAC2C
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NFW9
HTS Code 3002150000
Gene ID 25924
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MYRIP Antibody 100ul

Anti-MYRIP Antibody 100ul