UBTF,NOR-90,UBF
  • UBTF,NOR-90,UBF

Anti-UBTF Antibody 25ul

Ref: AN-HPA006385-25ul
Anti-UBTF

Información del producto

Polyclonal Antibody against Human UBTF, Gene description: upstream binding transcription factor, RNA polymerase I, Alternative Gene Names: NOR-90, UBF, UBF1, UBF2, Validated applications: ICC, IHC, WB, Uniprot ID: P17480, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name UBTF
Gene Description upstream binding transcription factor, RNA polymerase I
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse
Applications ICC, IHC, WB
Sequence WKLLSQKEKDAYHKKCDQKKKDYEVELLRFLESLPEEEQQRVLGEEKMLNINKKQATSPASKKPAQEGGKGGSEKPKRPVSAMFIFSEEKRRQLQEERPELSESELTRLLARMWNDLSEKKK
Immunogen WKLLSQKEKDAYHKKCDQKKKDYEVELLRFLESLPEEEQQRVLGEEKMLNINKKQATSPASKKPAQEGGKGGSEKPKRPVSAMFIFSEEKRRQLQEERPELSESELTRLLARMWNDLSEKKK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names NOR-90, UBF, UBF1, UBF2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P17480
HTS Code 3002150000
Gene ID 7343
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-UBTF Antibody 25ul

Anti-UBTF Antibody 25ul