PCYT1B,CCT-beta,CTB
  • PCYT1B,CCT-beta,CTB

Anti-PCYT1B Antibody 100ul

Ref: AN-HPA006367-100ul
Anti-PCYT1B

Información del producto

Polyclonal Antibody against Human PCYT1B, Gene description: phosphate cytidylyltransferase 1, choline, beta, Alternative Gene Names: CCT-beta, CTB, Validated applications: IHC, Uniprot ID: Q9Y5K3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PCYT1B
Gene Description phosphate cytidylyltransferase 1, choline, beta
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PVVTTDAESETGIPKSLSNEPPSETMEEIEHTCPQPRLTLTAPAPFADETNCQCQAPHEKLTIAQARLGTPADRPVRVYADGIFDLFHSGHARALMQAKTLFPNSYLLVGV
Immunogen PVVTTDAESETGIPKSLSNEPPSETMEEIEHTCPQPRLTLTAPAPFADETNCQCQAPHEKLTIAQARLGTPADRPVRVYADGIFDLFHSGHARALMQAKTLFPNSYLLVGV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CCT-beta, CTB
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y5K3
HTS Code 3002150000
Gene ID 9468
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PCYT1B Antibody 100ul

Anti-PCYT1B Antibody 100ul