ISY1,fSAP33,KIAA1160
  • ISY1,fSAP33,KIAA1160

Anti-ISY1 Antibody 25ul

Ref: AN-HPA006312-25ul
Anti-ISY1

Información del producto

Polyclonal Antibody against Human ISY1, Gene description: ISY1 splicing factor homolog (S. cerevisiae), Alternative Gene Names: fSAP33, KIAA1160, Validated applications: IHC, WB, Uniprot ID: Q9ULR0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ISY1
Gene Description ISY1 splicing factor homolog (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC
Sequence GKVKERRPFLASECTELPKAEKWRRQIIGEISKKVAQIQNAGLGEFRIRDLNDEINKLLREKGHWEVRIKELGGPDYGKVGPKMLDHEGKEVPGNRGYKYFGAAKDLPGVRELFEKEPLPPPRK
Immunogen GKVKERRPFLASECTELPKAEKWRRQIIGEISKKVAQIQNAGLGEFRIRDLNDEINKLLREKGHWEVRIKELGGPDYGKVGPKMLDHEGKEVPGNRGYKYFGAAKDLPGVRELFEKEPLPPPRK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names fSAP33, KIAA1160
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9ULR0
HTS Code 3002150000
Gene ID 57461
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ISY1 Antibody 25ul

Anti-ISY1 Antibody 25ul