LZTS1,FEZ1
  • LZTS1,FEZ1

Anti-LZTS1 Antibody 100ul

Ref: AN-HPA006294-100ul
Anti-LZTS1

Información del producto

Polyclonal Antibody against Human LZTS1, Gene description: leucine zipper, putative tumor suppressor 1, Alternative Gene Names: FEZ1, Validated applications: ICC, IHC, WB, Uniprot ID: Q9Y250, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name LZTS1
Gene Description leucine zipper, putative tumor suppressor 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence TEVNAKASEILGLKAQLKDTRGKLEGLELRTQDLEGALRTKGLELEVCENELQRKKNEAELLREKVNLLEQELQELRAQAALARDMGPPTFPEDVPALQRELERLRAELREERQGHDQMSSGFQHERLVWKE
Immunogen TEVNAKASEILGLKAQLKDTRGKLEGLELRTQDLEGALRTKGLELEVCENELQRKKNEAELLREKVNLLEQELQELRAQAALARDMGPPTFPEDVPALQRELERLRAELREERQGHDQMSSGFQHERLVWKE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FEZ1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y250
HTS Code 3002150000
Gene ID 11178
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-LZTS1 Antibody 100ul

Anti-LZTS1 Antibody 100ul