RBFOX2,FOX-2,HNRBP2
  • RBFOX2,FOX-2,HNRBP2

Anti-RBFOX2 Antibody 100ul

Ref: AN-HPA006240-100ul
Anti-RBFOX2

Información del producto

Polyclonal Antibody against Human RBFOX2, Gene description: RNA binding protein, fox-1 homolog (C. elegans) 2, Alternative Gene Names: FOX-2, HNRBP2, HRNBP2, RBM9, Validated applications: ICC, IHC, WB, Uniprot ID: O43251, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RBFOX2
Gene Description RNA binding protein, fox-1 homolog (C. elegans) 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence PTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSL
Immunogen PTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FOX-2, HNRBP2, HRNBP2, RBM9
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O43251
HTS Code 3002150000
Gene ID 23543
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RBFOX2 Antibody 100ul

Anti-RBFOX2 Antibody 100ul