MTA2,MTA1-L1,MTA1L1
  • MTA2,MTA1-L1,MTA1L1

Anti-MTA2 Antibody 100ul

Ref: AN-HPA006214-100ul
Anti-MTA2

Información del producto

Polyclonal Antibody against Human MTA2, Gene description: metastasis associated 1 family, member 2, Alternative Gene Names: MTA1-L1, MTA1L1, Validated applications: ICC, IHC, WB, Uniprot ID: O94776, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MTA2
Gene Description metastasis associated 1 family, member 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications ICC, IHC, WB
Sequence ECSIRLPKAAKTPLKIHPLVRLPLATIVKDLVAQAPLKPKTPRGTKTPINRNQLSQNRGLGGIMVKRAYETMAGAGVPFSANGRPLASGIRSSSQPAAKRQKLNPADAPNPVVFVATKDTRALRKALTHLEMRRAARRPNLPLKVKPT
Immunogen ECSIRLPKAAKTPLKIHPLVRLPLATIVKDLVAQAPLKPKTPRGTKTPINRNQLSQNRGLGGIMVKRAYETMAGAGVPFSANGRPLASGIRSSSQPAAKRQKLNPADAPNPVVFVATKDTRALRKALTHLEMRRAARRPNLPLKVKPT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MTA1-L1, MTA1L1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O94776
HTS Code 3002150000
Gene ID 9219
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MTA2 Antibody 100ul

Anti-MTA2 Antibody 100ul