UCHL1,PARK5,PGP9.5
  • UCHL1,PARK5,PGP9.5

Anti-UCHL1 Antibody 100ul

Ref: AN-HPA005993-100ul
Anti-UCHL1

Información del producto

Polyclonal Antibody against Human UCHL1, Gene description: ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase), Alternative Gene Names: PARK5, PGP9.5, Uch-L1, Validated applications: ICC, IHC, WB, Uniprot ID: P09936, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name UCHL1
Gene Description ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC, ICC
Sequence QEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVAL
Immunogen QEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVAL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PARK5, PGP9.5, Uch-L1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P09936
HTS Code 3002150000
Gene ID 7345
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-UCHL1 Antibody 100ul

Anti-UCHL1 Antibody 100ul