UCHL5,CGI-70,INO80R
  • UCHL5,CGI-70,INO80R

Anti-UCHL5 Antibody 100ul

Ref: AN-HPA005908-100ul
Anti-UCHL5

Información del producto

Polyclonal Antibody against Human UCHL5, Gene description: ubiquitin carboxyl-terminal hydrolase L5, Alternative Gene Names: CGI-70, INO80R, UCH37, Validated applications: IHC, Uniprot ID: Q9Y5K5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name UCHL5
Gene Description ubiquitin carboxyl-terminal hydrolase L5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence CTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKT
Immunogen CTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-70, INO80R, UCH37
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y5K5
HTS Code 3002150000
Gene ID 51377
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-UCHL5 Antibody 100ul

Anti-UCHL5 Antibody 100ul