L1CAM,CD171,HSAS
  • L1CAM,CD171,HSAS

Anti-L1CAM Antibody 25ul

Ref: AN-HPA005830-25ul
Anti-L1CAM

Información del producto

Polyclonal Antibody against Human L1CAM, Gene description: L1 cell adhesion molecule, Alternative Gene Names: CD171, HSAS, HSAS1, MASA, MIC5, S10, SPG1, Validated applications: IHC, Uniprot ID: P32004, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name L1CAM
Gene Description L1 cell adhesion molecule
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence ELRTHNLTDLSPHLRYRFQLQATTKEGPGEAIVREGGTMALSGISDFGNISATAGENYSVVSWVPKEGQCNFRFHILFKALGEEKGGASLSPQYVSYNQSSYTQWDLQPDTDYEIHLFKERMFRHQMAVKTNGTGRVRLPPAGFATE
Immunogen ELRTHNLTDLSPHLRYRFQLQATTKEGPGEAIVREGGTMALSGISDFGNISATAGENYSVVSWVPKEGQCNFRFHILFKALGEEKGGASLSPQYVSYNQSSYTQWDLQPDTDYEIHLFKERMFRHQMAVKTNGTGRVRLPPAGFATE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CD171, HSAS, HSAS1, MASA, MIC5, S10, SPG1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P32004
HTS Code 3002150000
Gene ID 3897
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-L1CAM Antibody 25ul

Anti-L1CAM Antibody 25ul