GRHL1,LBP-32,MGR
  • GRHL1,LBP-32,MGR

Anti-GRHL1 Antibody 25ul

Ref: AN-HPA005798-25ul
Anti-GRHL1

Información del producto

Polyclonal Antibody against Human GRHL1, Gene description: grainyhead-like 1 (Drosophila), Alternative Gene Names: LBP-32, MGR, TFCP2L2, Validated applications: ICC, IHC, WB, Uniprot ID: Q9NZI5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name GRHL1
Gene Description grainyhead-like 1 (Drosophila)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC, ICC
Sequence TVFKPFIDLDTQPVLFIPDVHFANLQRGTHVLPIASEELEGEGSVLKRGPYGTEDDFAVPPSTKLARIEEPKRVLLYVRKESEEVFDALMLKTPSLKGL
Immunogen TVFKPFIDLDTQPVLFIPDVHFANLQRGTHVLPIASEELEGEGSVLKRGPYGTEDDFAVPPSTKLARIEEPKRVLLYVRKESEEVFDALMLKTPSLKGL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names LBP-32, MGR, TFCP2L2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NZI5
HTS Code 3002150000
Gene ID 29841
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-GRHL1 Antibody 25ul

Anti-GRHL1 Antibody 25ul