SEC16A,KIAA0310,p250
  • SEC16A,KIAA0310,p250

Anti-SEC16A Antibody 25ul

Ref: AN-HPA005684-25ul
Anti-SEC16A

Información del producto

Polyclonal Antibody against Human SEC16A, Gene description: SEC16 homolog A (S. cerevisiae), Alternative Gene Names: KIAA0310, p250, Validated applications: ICC, IHC, WB, Uniprot ID: O15027, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SEC16A
Gene Description SEC16 homolog A (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence PLPIPSNLFVPTPDAEEPQLPDGTGREGPAAARGLANPEPAPEPKAPGDLPAAGGPPSGAMPFYNPAQ
Immunogen PLPIPSNLFVPTPDAEEPQLPDGTGREGPAAARGLANPEPAPEPKAPGDLPAAGGPPSGAMPFYNPAQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0310, p250
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O15027
HTS Code 3002150000
Gene ID 9919
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SEC16A Antibody 25ul

Anti-SEC16A Antibody 25ul