AATF,BFR2,CHE-1
  • AATF,BFR2,CHE-1

Anti-AATF Antibody 100ul

Ref: AN-HPA004940-100ul
Anti-AATF

Información del producto

Polyclonal Antibody against Human AATF, Gene description: apoptosis antagonizing transcription factor, Alternative Gene Names: BFR2, CHE-1, CHE1, DED, Validated applications: IHC, Uniprot ID: Q9NY61, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name AATF
Gene Description apoptosis antagonizing transcription factor
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SVQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLTTNQLPQPDVFPLFKDKGGPEFSSALKNSHKALKALLTSLVGLQ
Immunogen SVQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLTTNQLPQPDVFPLFKDKGGPEFSSALKNSHKALKALLTSLVGLQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BFR2, CHE-1, CHE1, DED
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NY61
HTS Code 3002150000
Gene ID 26574
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-AATF Antibody 100ul

Anti-AATF Antibody 100ul