ARPC1B,ARC41
  • ARPC1B,ARC41

Anti-ARPC1B Antibody 25ul

Ref: AN-HPA004832-25ul
Anti-ARPC1B

Información del producto

Polyclonal Antibody against Human ARPC1B, Gene description: actin related protein 2/3 complex, subunit 1B, 41kDa, Alternative Gene Names: ARC41, p40-ARC, p41-ARC, Validated applications: IHC, WB, Uniprot ID: O15143, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ARPC1B
Gene Description actin related protein 2/3 complex, subunit 1B, 41kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence TVCLADADKKMAVATLASETLPLLALTFITDNSLVAAGHDCFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESA
Immunogen TVCLADADKKMAVATLASETLPLLALTFITDNSLVAAGHDCFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ARC41, p40-ARC, p41-ARC
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O15143
HTS Code 3002150000
Gene ID 10095
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ARPC1B Antibody 25ul

Anti-ARPC1B Antibody 25ul