VEZT,DKFZP761C241
  • VEZT,DKFZP761C241

Anti-VEZT Antibody 100ul

Ref: AN-HPA004811-100ul
Anti-VEZT

Información del producto

Polyclonal Antibody against Human VEZT, Gene description: vezatin, adherens junctions transmembrane protein, Alternative Gene Names: DKFZP761C241, Validated applications: ICC, IHC, WB, Uniprot ID: Q9HBM0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name VEZT
Gene Description vezatin, adherens junctions transmembrane protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence DELEKLVCTKETQELVSEAYPILEQKLKLIQPHVQASNNCWEEAISQVDKLLRRNTDKKGKPEIACENPHCTVVPLKQPTLHIADKDPIPEEQELEAYVDDIDIDSDFRKDDFYYLSQEDKERQKREHEESKRVLQELKSVLG
Immunogen DELEKLVCTKETQELVSEAYPILEQKLKLIQPHVQASNNCWEEAISQVDKLLRRNTDKKGKPEIACENPHCTVVPLKQPTLHIADKDPIPEEQELEAYVDDIDIDSDFRKDDFYYLSQEDKERQKREHEESKRVLQELKSVLG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZP761C241
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9HBM0
HTS Code 3002150000
Gene ID 55591
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-VEZT Antibody 100ul

Anti-VEZT Antibody 100ul