PRKAB1
  • PRKAB1

Anti-PRKAB1 Antibody 25ul

Ref: AN-HPA004247-25ul
Anti-PRKAB1

Información del producto

Polyclonal Antibody against Human PRKAB1, Gene description: protein kinase, AMP-activated, beta 1 non-catalytic subunit, Validated applications: ICC, IHC, WB, Uniprot ID: Q9Y478, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PRKAB1
Gene Description protein kinase, AMP-activated, beta 1 non-catalytic subunit
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, ICC, IHC
Sequence MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNW
Immunogen MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNW
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y478
HTS Code 3002150000
Gene ID 5564
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PRKAB1 Antibody 25ul

Anti-PRKAB1 Antibody 25ul