RAB5C,RAB5CL,RABL
  • RAB5C,RAB5CL,RABL

Anti-RAB5C Antibody 25ul

Ref: AN-HPA004167-25ul
Anti-RAB5C

Información del producto

Polyclonal Antibody against Human RAB5C, Gene description: RAB5C, member RAS oncogene family, Alternative Gene Names: RAB5CL, RABL, Validated applications: ICC, Uniprot ID: P51148, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RAB5C
Gene Description RAB5C, member RAS oncogene family
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence NSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN
Immunogen NSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names RAB5CL, RABL
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P51148
HTS Code 3002150000
Gene ID 5878
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RAB5C Antibody 25ul

Anti-RAB5C Antibody 25ul