TAF10,TAF2A,TAF2H
  • TAF10,TAF2A,TAF2H

Anti-TAF10 Antibody 100ul

Ref: AN-HPA004148-100ul
Anti-TAF10

Información del producto

Polyclonal Antibody against Human TAF10, Gene description: TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa, Alternative Gene Names: TAF2A, TAF2H, TAFII30, Validated applications: ICC, IHC, Uniprot ID: Q12962, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TAF10
Gene Description TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence SNGVYVLPSAANGDVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKP
Immunogen SNGVYVLPSAANGDVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names TAF2A, TAF2H, TAFII30
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q12962
HTS Code 3002150000
Gene ID 6881
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TAF10 Antibody 100ul

Anti-TAF10 Antibody 100ul