RBM23,CAPERbeta
  • RBM23,CAPERbeta

Anti-RBM23 Antibody 100ul

Ref: AN-HPA004144-100ul
Anti-RBM23

Información del producto

Polyclonal Antibody against Human RBM23, Gene description: RNA binding motif protein 23, Alternative Gene Names: CAPERbeta, FLJ10482, RNPC4, Validated applications: ICC, IHC, WB, Uniprot ID: Q86U06, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RBM23
Gene Description RNA binding motif protein 23
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB, IHC
Sequence MASDDFDIVIEAMLEAPYKKEEDEQQRKEVKKDYPSNTTSSTSNSGNETSGSSTIGETSNRSRDRDRYRRRNSRSRSPGRQCRHRSRSWDRRHGSESRSRDHRREDRVHYRSPPLATGYRYGHSKSPHFREKSP
Immunogen MASDDFDIVIEAMLEAPYKKEEDEQQRKEVKKDYPSNTTSSTSNSGNETSGSSTIGETSNRSRDRDRYRRRNSRSRSPGRQCRHRSRSWDRRHGSESRSRDHRREDRVHYRSPPLATGYRYGHSKSPHFREKSP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CAPERbeta, FLJ10482, RNPC4
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q86U06
HTS Code 3002150000
Gene ID 55147
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RBM23 Antibody 100ul

Anti-RBM23 Antibody 100ul