TNFRSF1A,CD120a
  • TNFRSF1A,CD120a

Anti-TNFRSF1A Antibody 25ul

Ref: AN-HPA004102-25ul
Anti-TNFRSF1A

Información del producto

Polyclonal Antibody against Human TNFRSF1A, Gene description: tumor necrosis factor receptor superfamily, member 1A, Alternative Gene Names: CD120a, TNF-R, TNF-R-I, TNF-R55, TNFAR, TNFR1, TNFR60, Validated applications: IHC, WB, Uniprot ID: P19438, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TNFRSF1A
Gene Description tumor necrosis factor receptor superfamily, member 1A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence GDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSC
Immunogen GDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CD120a, TNF-R, TNF-R-I, TNF-R55, TNFAR, TNFR1, TNFR60
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P19438
HTS Code 3002150000
Gene ID 7132
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TNFRSF1A Antibody 25ul

Anti-TNFRSF1A Antibody 25ul