C17orf75,NJMU-R1
  • C17orf75,NJMU-R1

Anti-C17orf75 Antibody 25ul

Ref: AN-HPA004061-25ul
Anti-C17orf75

Información del producto

Polyclonal Antibody against Human C17orf75, Gene description: chromosome 17 open reading frame 75, Alternative Gene Names: NJMU-R1, Validated applications: ICC, IHC, WB, Uniprot ID: Q9HAS0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name C17orf75
Gene Description chromosome 17 open reading frame 75
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse
Applications ICC, IHC, WB
Sequence PSSSHYCLYSYRGSRLAQQRGDSEDGSPSGTNAETPSGDDFSLSLADTNLPSEVEPELRSFIAKRLSRGAVFEGLGNVASVELKIPGYRVGCYYCLFQNEKLLPETVTI
Immunogen PSSSHYCLYSYRGSRLAQQRGDSEDGSPSGTNAETPSGDDFSLSLADTNLPSEVEPELRSFIAKRLSRGAVFEGLGNVASVELKIPGYRVGCYYCLFQNEKLLPETVTI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names NJMU-R1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9HAS0
HTS Code 3002150000
Gene ID 64149
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-C17orf75 Antibody 25ul

Anti-C17orf75 Antibody 25ul