G3BP1,G3BP,HDH-VIII
  • G3BP1,G3BP,HDH-VIII

Anti-G3BP1 Antibody 100ul

Ref: AN-HPA004052-100ul
Anti-G3BP1

Información del producto

Polyclonal Antibody against Human G3BP1, Gene description: GTPase activating protein (SH3 domain) binding protein 1, Alternative Gene Names: G3BP, HDH-VIII, Validated applications: ICC, IHC, WB, Uniprot ID: Q13283, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name G3BP1
Gene Description GTPase activating protein (SH3 domain) binding protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications ICC, IHC, WB
Sequence FRYQDEVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEEHLEEPVAEPEPDPEPEPEQEPVSEIQEEKPEPVLEETAP
Immunogen FRYQDEVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEEHLEEPVAEPEPDPEPEPEQEPVSEIQEEKPEPVLEETAP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names G3BP, HDH-VIII
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13283
HTS Code 3002150000
Gene ID 10146
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-G3BP1 Antibody 100ul

Anti-G3BP1 Antibody 100ul