UBP1,LBP-1a
  • UBP1,LBP-1a

Anti-UBP1 Antibody 100ul

Ref: AN-HPA003967-100ul
Anti-UBP1

Información del producto

Polyclonal Antibody against Human UBP1, Gene description: upstream binding protein 1 (LBP-1a), Alternative Gene Names: LBP-1a, Validated applications: ICC, WB, Uniprot ID: Q9NZI7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name UBP1
Gene Description upstream binding protein 1 (LBP-1a)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence TAYVNNSPSPAPTFTSPQQSTCSVPDSNSSSPNHQGDGASQTSGEQIQPSATIQETQQWLLKNRFSSYTRLFSNFSGADLLKLTKEDLVQICGAADGIRLYNSLKSRSVRPRLTIYVCREQPSSTVLQGQQQAASSASENGSGA
Immunogen TAYVNNSPSPAPTFTSPQQSTCSVPDSNSSSPNHQGDGASQTSGEQIQPSATIQETQQWLLKNRFSSYTRLFSNFSGADLLKLTKEDLVQICGAADGIRLYNSLKSRSVRPRLTIYVCREQPSSTVLQGQQQAASSASENGSGA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names LBP-1a
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NZI7
HTS Code 3002150000
Gene ID 7342
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-UBP1 Antibody 100ul

Anti-UBP1 Antibody 100ul