BCAP31,6C6-Ag,BAP31
  • BCAP31,6C6-Ag,BAP31

Anti-BCAP31 Antibody 100ul

Ref: AN-HPA003906-100ul
Anti-BCAP31

Información del producto

Polyclonal Antibody against Human BCAP31, Gene description: B-cell receptor-associated protein 31, Alternative Gene Names: 6C6-Ag, BAP31, CDM, DXS1357E, Validated applications: ICC, IHC, WB, Uniprot ID: P51572, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name BCAP31
Gene Description B-cell receptor-associated protein 31
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, ICC, IHC
Sequence ESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGP
Immunogen ESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 6C6-Ag, BAP31, CDM, DXS1357E
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P51572
HTS Code 3002150000
Gene ID 10134
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-BCAP31 Antibody 100ul

Anti-BCAP31 Antibody 100ul