MCM7,CDC47,MCM2
  • MCM7,CDC47,MCM2

Anti-MCM7 Antibody 25ul

Ref: AN-HPA003898-25ul
Anti-MCM7

Información del producto

Polyclonal Antibody against Human MCM7, Gene description: minichromosome maintenance complex component 7, Alternative Gene Names: CDC47, MCM2, PPP1R104, Validated applications: ICC, IHC, WB, Uniprot ID: P33993, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MCM7
Gene Description minichromosome maintenance complex component 7
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC, ICC
Sequence QSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSRFIKFQEMKMQEHSDQVPVGNIPRSITVLVEGENTRIAQPGDHVSVTGIFLPILRTGFRQVVQGLLSETYLEAHRIVKMNKSEDDESGAGE
Immunogen QSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSRFIKFQEMKMQEHSDQVPVGNIPRSITVLVEGENTRIAQPGDHVSVTGIFLPILRTGFRQVVQGLLSETYLEAHRIVKMNKSEDDESGAGE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CDC47, MCM2, PPP1R104
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P33993
HTS Code 3002150000
Gene ID 4176
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MCM7 Antibody 25ul

Anti-MCM7 Antibody 25ul