FOXP1,12CC4,hFKH1B
  • FOXP1,12CC4,hFKH1B

Anti-FOXP1 Antibody 25ul

Ref: AN-HPA003876-25ul
Anti-FOXP1

Información del producto

Polyclonal Antibody against Human FOXP1, Gene description: forkhead box P1, Alternative Gene Names: 12CC4, hFKH1B, HSPC215, QRF1, Validated applications: ICC, IHC, WB, Uniprot ID: Q9H334, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FOXP1
Gene Description forkhead box P1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC, ICC
Sequence QMQQLQQQHLLSLQRQGLLTIQPGQPALPLQPLAQGMIPTELQQLWKEVTSAHTAEETTGNNHSSLDLTTTCVSSSAPSKTSLIMNPHASTNGQLSVHTPKRESLSHEEHPHSHPLYGHGVCKWPGCEAVCEDFQSFLKHLNS
Immunogen QMQQLQQQHLLSLQRQGLLTIQPGQPALPLQPLAQGMIPTELQQLWKEVTSAHTAEETTGNNHSSLDLTTTCVSSSAPSKTSLIMNPHASTNGQLSVHTPKRESLSHEEHPHSHPLYGHGVCKWPGCEAVCEDFQSFLKHLNS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 12CC4, hFKH1B, HSPC215, QRF1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H334
HTS Code 3002150000
Gene ID 27086
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-FOXP1 Antibody 25ul

Anti-FOXP1 Antibody 25ul