FAM50A,9F,DXS9928E
  • FAM50A,9F,DXS9928E

Anti-FAM50A Antibody 25ul

Ref: AN-HPA003585-25ul
Anti-FAM50A

Información del producto

Polyclonal Antibody against Human FAM50A, Gene description: family with sequence similarity 50, member A, Alternative Gene Names: 9F, DXS9928E, HXC-26, XAP5, Validated applications: ICC, IHC, WB, Uniprot ID: Q14320, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FAM50A
Gene Description family with sequence similarity 50, member A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence VTLNDMKAKQEALVKEREKQLAKKEQSKELQMKLEKLREKERKKEAKRKISSLSFTLEEEEEGGEEEEEAAMYEEEMEREEITTKKRKLGKNPDVDTSFLPDRDRE
Immunogen VTLNDMKAKQEALVKEREKQLAKKEQSKELQMKLEKLREKERKKEAKRKISSLSFTLEEEEEGGEEEEEAAMYEEEMEREEITTKKRKLGKNPDVDTSFLPDRDRE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 9F, DXS9928E, HXC-26, XAP5
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q14320
HTS Code 3002150000
Gene ID 9130
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-FAM50A Antibody 25ul

Anti-FAM50A Antibody 25ul