PARP12,FLJ22693
  • PARP12,FLJ22693

Anti-PARP12 Antibody 100ul

Ref: AN-HPA003584-100ul
Anti-PARP12

Información del producto

Polyclonal Antibody against Human PARP12, Gene description: poly (ADP-ribose) polymerase family, member 12, Alternative Gene Names: FLJ22693, PARP-12, ZC3H1, ZC3HDC1, Validated applications: IHC, Uniprot ID: Q9H0J9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PARP12
Gene Description poly (ADP-ribose) polymerase family, member 12
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence AATLKFQAGKHNYELDFKAFVQKNLVYGTTKKVCRRPKYVSPQDVTTMQTCNTKFPGPKSIPDYWDSSALPDPGFQKITLSSSSEEYQKVWNLFNRTLPFYFVQKIERVQNLALWEVYQWQKGQMQKQNGG
Immunogen AATLKFQAGKHNYELDFKAFVQKNLVYGTTKKVCRRPKYVSPQDVTTMQTCNTKFPGPKSIPDYWDSSALPDPGFQKITLSSSSEEYQKVWNLFNRTLPFYFVQKIERVQNLALWEVYQWQKGQMQKQNGG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ22693, PARP-12, ZC3H1, ZC3HDC1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H0J9
HTS Code 3002150000
Gene ID 64761
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PARP12 Antibody 100ul

Anti-PARP12 Antibody 100ul