UQCRC1,D3S3191,QCR1
  • UQCRC1,D3S3191,QCR1

Anti-UQCRC1 Antibody 100ul

Ref: AN-HPA003525-100ul
Anti-UQCRC1

Información del producto

Polyclonal Antibody against Human UQCRC1, Gene description: ubiquinol-cytochrome c reductase core protein I, Alternative Gene Names: D3S3191, QCR1, UQCR1, Validated applications: IHC, WB, Uniprot ID: P31930, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name UQCRC1
Gene Description ubiquinol-cytochrome c reductase core protein I
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence DDALPFAHVAIAVEGPGWASPDNVALQVANAIIGHYDCTYGGGVHLSSPLASGAVANKLCQSFQTFSICYAETGLLGAHFVCDRMKIDDMMFVLQGQWMRLCTSATESEVARGKNILRNALVSHLDGTTPVCEDIGR
Immunogen DDALPFAHVAIAVEGPGWASPDNVALQVANAIIGHYDCTYGGGVHLSSPLASGAVANKLCQSFQTFSICYAETGLLGAHFVCDRMKIDDMMFVLQGQWMRLCTSATESEVARGKNILRNALVSHLDGTTPVCEDIGR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names D3S3191, QCR1, UQCR1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P31930
HTS Code 3002150000
Gene ID 7384
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-UQCRC1 Antibody 100ul

Anti-UQCRC1 Antibody 100ul