CTSH,ACC-4,ACC-5
  • CTSH,ACC-4,ACC-5

Anti-CTSH Antibody 25ul

Ref: AN-HPA003524-25ul
Anti-CTSH

Información del producto

Polyclonal Antibody against Human CTSH, Gene description: cathepsin H, Alternative Gene Names: ACC-4, ACC-5, CPSB, Validated applications: ICC, IHC, Uniprot ID: P09668, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CTSH
Gene Description cathepsin H
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence LPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPGKAIGFVKDVANITIYDEEAMVEAVALYNPVSFAFEVTQDFMMYRTGIYSSTSCHKTPDKVNHAVLAVGYGEKNGIPYWIVKNSWGPQWGMNGYFL
Immunogen LPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPGKAIGFVKDVANITIYDEEAMVEAVALYNPVSFAFEVTQDFMMYRTGIYSSTSCHKTPDKVNHAVLAVGYGEKNGIPYWIVKNSWGPQWGMNGYFL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ACC-4, ACC-5, CPSB
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P09668
HTS Code 3002150000
Gene ID 1512
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CTSH Antibody 25ul

Anti-CTSH Antibody 25ul