ZKSCAN8,LD5-1
  • ZKSCAN8,LD5-1

Anti-ZKSCAN8 Antibody 25ul

Ref: AN-HPA003483-25ul
Anti-ZKSCAN8

Información del producto

Polyclonal Antibody against Human ZKSCAN8, Gene description: zinc finger with KRAB and SCAN domains 8, Alternative Gene Names: LD5-1, ZNF192, ZSCAN40, Validated applications: ICC, IHC, WB, Uniprot ID: Q15776, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ZKSCAN8
Gene Description zinc finger with KRAB and SCAN domains 8
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence VKEHQLENGEEVVTLLEDLERQIDILGRPVSARVHGHRVLWEEVVHSASAPEPPNTQLQSEATQHKSPVPQESQERAMSTSQSPTRSQKGSSGDQEMTATLLTAGFQTLEKIED
Immunogen VKEHQLENGEEVVTLLEDLERQIDILGRPVSARVHGHRVLWEEVVHSASAPEPPNTQLQSEATQHKSPVPQESQERAMSTSQSPTRSQKGSSGDQEMTATLLTAGFQTLEKIED
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names LD5-1, ZNF192, ZSCAN40
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15776
HTS Code 3002150000
Gene ID 7745
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ZKSCAN8 Antibody 25ul

Anti-ZKSCAN8 Antibody 25ul