ELF3,EPR-1,ERT
  • ELF3,EPR-1,ERT

Anti-ELF3 Antibody 100ul

Ref: AN-HPA003479-100ul
Anti-ELF3

Información del producto

Polyclonal Antibody against Human ELF3, Gene description: E74-like factor 3 (ets domain transcription factor, epithelial-specific ), Alternative Gene Names: EPR-1, ERT, ESE-1, ESX, Validated applications: IHC, WB, Uniprot ID: P78545, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ELF3
Gene Description E74-like factor 3 (ets domain transcription factor, epithelial-specific )
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence ATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGADDLVLTLSNPQMSLEGTEKASWLGEQPQFWSKTQVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQLHAQLRDLTSSSSDELSWIIELLEKDGMA
Immunogen ATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGADDLVLTLSNPQMSLEGTEKASWLGEQPQFWSKTQVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQLHAQLRDLTSSSSDELSWIIELLEKDGMA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names EPR-1, ERT, ESE-1, ESX
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P78545
HTS Code 3002150000
Gene ID 1999
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ELF3 Antibody 100ul

Anti-ELF3 Antibody 100ul