ZEB2,KIAA0569,SIP-1
  • ZEB2,KIAA0569,SIP-1

Anti-ZEB2 Antibody 100ul

Ref: AN-HPA003456-100ul
Anti-ZEB2

Información del producto

Polyclonal Antibody against Human ZEB2, Gene description: zinc finger E-box binding homeobox 2, Alternative Gene Names: KIAA0569, SIP-1, SIP1, ZFHX1B, Validated applications: IHC, WB, Uniprot ID: O60315, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ZEB2
Gene Description zinc finger E-box binding homeobox 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence SPVKPMDSITSPSIAELHNSVTNCDPPLRLTKPSHFTNIKPVEKLDHSRSNTPSPLNLSSTSSKNSHSSSYTPNSFSSEELQAEPLDLSLPKQMKEPKSIIATKNKTKASSISLDHNSVSSSSE
Immunogen SPVKPMDSITSPSIAELHNSVTNCDPPLRLTKPSHFTNIKPVEKLDHSRSNTPSPLNLSSTSSKNSHSSSYTPNSFSSEELQAEPLDLSLPKQMKEPKSIIATKNKTKASSISLDHNSVSSSSE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0569, SIP-1, SIP1, ZFHX1B
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O60315
HTS Code 3002150000
Gene ID 9839
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ZEB2 Antibody 100ul

Anti-ZEB2 Antibody 100ul