TFF1,BCEI,D21S21
  • TFF1,BCEI,D21S21

Anti-TFF1 Antibody 25ul

Ref: AN-HPA003425-25ul
Anti-TFF1

Información del producto

Polyclonal Antibody against Human TFF1, Gene description: trefoil factor 1, Alternative Gene Names: BCEI, D21S21, HP1.A, HPS2, pNR-2, pS2, Validated applications: IHC, WB, Uniprot ID: P04155, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TFF1
Gene Description trefoil factor 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence QTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPE
Immunogen QTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BCEI, D21S21, HP1.A, HPS2, pNR-2, pS2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P04155
HTS Code 3002150000
Gene ID 7031
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TFF1 Antibody 25ul

Anti-TFF1 Antibody 25ul