MSL2,FLJ10546
  • MSL2,FLJ10546

Anti-MSL2 Antibody 100ul

Ref: AN-HPA003413-100ul
Anti-MSL2

Información del producto

Polyclonal Antibody against Human MSL2, Gene description: male-specific lethal 2 homolog (Drosophila), Alternative Gene Names: FLJ10546, KIAA1585, msl-2, MSL2L1, RNF184, Validated applications: WB, Uniprot ID: Q9HCI7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MSL2
Gene Description male-specific lethal 2 homolog (Drosophila)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB
Sequence SPEHSNTIDVCNTVDIKTEDLSDSLPPVCDTVATDLCSTGIDICSFSEDIKPGDSLLLSVEEVLRSLETVSNTEVCCPNLQPNLEATVSNGPFLQLSSQSLSHNVFMSTSPALHGLSCTAATPKIAKLNRKRSRSESDSEKVQ
Immunogen SPEHSNTIDVCNTVDIKTEDLSDSLPPVCDTVATDLCSTGIDICSFSEDIKPGDSLLLSVEEVLRSLETVSNTEVCCPNLQPNLEATVSNGPFLQLSSQSLSHNVFMSTSPALHGLSCTAATPKIAKLNRKRSRSESDSEKVQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ10546, KIAA1585, msl-2, MSL2L1, RNF184
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9HCI7
HTS Code 3002150000
Gene ID 55167
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MSL2 Antibody 100ul

Anti-MSL2 Antibody 100ul