IVNS1ABP,HSPC068
  • IVNS1ABP,HSPC068

Anti-IVNS1ABP Antibody 100ul

Ref: AN-HPA003405-100ul
Anti-IVNS1ABP

Información del producto

Polyclonal Antibody against Human IVNS1ABP, Gene description: influenza virus NS1A binding protein, Alternative Gene Names: HSPC068, KIAA0850, KLHL39, ND1, NS-1, NS1-BP, Validated applications: ICC, IHC, WB, Uniprot ID: Q9Y6Y0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name IVNS1ABP
Gene Description influenza virus NS1A binding protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence QDELIEKPMSPMQYARSGLGTAEMNGKLIAAGGYNREECLRTVECYNPHTDHWSFLAPMRTPRARFQMAVLMGQLYVVGGSNGHSDDLSCGEMYDSNIDDWIPVPELRTNRCNAGVCALNGKLYIVGGSD
Immunogen QDELIEKPMSPMQYARSGLGTAEMNGKLIAAGGYNREECLRTVECYNPHTDHWSFLAPMRTPRARFQMAVLMGQLYVVGGSNGHSDDLSCGEMYDSNIDDWIPVPELRTNRCNAGVCALNGKLYIVGGSD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HSPC068, KIAA0850, KLHL39, ND1, NS-1, NS1-BP
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y6Y0
HTS Code 3002150000
Gene ID 10625
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-IVNS1ABP Antibody 100ul

Anti-IVNS1ABP Antibody 100ul