NDUFV2,CI-24k
  • NDUFV2,CI-24k

Anti-NDUFV2 Antibody 100ul

Ref: AN-HPA003404-100ul
Anti-NDUFV2

Información del producto

Polyclonal Antibody against Human NDUFV2, Gene description: NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa, Alternative Gene Names: CI-24k, Validated applications: IHC, Uniprot ID: P19404, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NDUFV2
Gene Description NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAKDIEE
Immunogen PEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAKDIEE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CI-24k
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P19404
HTS Code 3002150000
Gene ID 4729
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NDUFV2 Antibody 100ul

Anti-NDUFV2 Antibody 100ul