S100A10,42C,ANX2LG
  • S100A10,42C,ANX2LG

Anti-S100A10 Antibody 25ul

Ref: AN-HPA003340-25ul
Anti-S100A10

Información del producto

Polyclonal Antibody against Human S100A10, Gene description: S100 calcium binding protein A10, Alternative Gene Names: 42C, ANX2LG, CAL1L, CLP11, P11, Validated applications: ICC, IHC, WB, Uniprot ID: P60903, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name S100A10
Gene Description S100 calcium binding protein A10
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKV
Immunogen MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 42C, ANX2LG, CAL1L, CLP11, P11
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P60903
HTS Code 3002150000
Gene ID 6281
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-S100A10 Antibody 25ul

Anti-S100A10 Antibody 25ul