DUSP9,MKP-4,MKP4
  • DUSP9,MKP-4,MKP4

Anti-DUSP9 Antibody 100ul

Ref: AN-HPA003336-100ul
Anti-DUSP9

Información del producto

Polyclonal Antibody against Human DUSP9, Gene description: dual specificity phosphatase 9, Alternative Gene Names: MKP-4, MKP4, Validated applications: IHC, Uniprot ID: Q99956, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DUSP9
Gene Description dual specificity phosphatase 9
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence ECPHLCETSLAGRAGSSMAPVPGPVPVVGLGSLCLGSDCSDAESEADRDSMSCGLDSEGATPPPVGLRASFPVQILPNLYLGSARDSANLESLAKLGIRYILNVTPNLPNFFEKNGDFHYKQI
Immunogen ECPHLCETSLAGRAGSSMAPVPGPVPVVGLGSLCLGSDCSDAESEADRDSMSCGLDSEGATPPPVGLRASFPVQILPNLYLGSARDSANLESLAKLGIRYILNVTPNLPNFFEKNGDFHYKQI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MKP-4, MKP4
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q99956
HTS Code 3002150000
Gene ID 1852
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DUSP9 Antibody 100ul

Anti-DUSP9 Antibody 100ul