OPTN,FIP-2,FIP2
  • OPTN,FIP-2,FIP2

Anti-OPTN Antibody 25ul

Ref: AN-HPA003279-25ul
Anti-OPTN

Información del producto

Polyclonal Antibody against Human OPTN, Gene description: optineurin, Alternative Gene Names: FIP-2, FIP2, GLC1E, HIP7, HYPL, NRP, TFIIIA-INTP, Validated applications: ICC, IHC, WB, Uniprot ID: Q96CV9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name OPTN
Gene Description optineurin
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence LELAEKALASKQLQMDEMKQTIAKQEEDLETMTILRAQMEVYCSDFHAERAAREKIHEEKEQLALQLAVLLKENDAFEDGGRQSLMEMQSRHGARTSDSDQQAYLVQRGAEDRDWRQQRNIPIHSCPKCGEVL
Immunogen LELAEKALASKQLQMDEMKQTIAKQEEDLETMTILRAQMEVYCSDFHAERAAREKIHEEKEQLALQLAVLLKENDAFEDGGRQSLMEMQSRHGARTSDSDQQAYLVQRGAEDRDWRQQRNIPIHSCPKCGEVL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FIP-2, FIP2, GLC1E, HIP7, HYPL, NRP, TFIIIA-INTP
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96CV9
HTS Code 3002150000
Gene ID 10133
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-OPTN Antibody 25ul

Anti-OPTN Antibody 25ul