PDIA3,ERp57,ERp60
  • PDIA3,ERp57,ERp60

Anti-PDIA3 Antibody 25ul

Ref: AN-HPA003230-25ul
Anti-PDIA3

Información del producto

Polyclonal Antibody against Human PDIA3, Gene description: protein disulfide isomerase family A, member 3, Alternative Gene Names: ERp57, ERp60, ERp61, GRP57, GRP58, HsT17083, P58, PI-PLC, Validated applications: ICC, IHC, WB, Uniprot ID: P30101, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PDIA3
Gene Description protein disulfide isomerase family A, member 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC, ICC
Sequence PTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDK
Immunogen PTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ERp57, ERp60, ERp61, GRP57, GRP58, HsT17083, P58, PI-PLC
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P30101
HTS Code 3002150000
Gene ID 2923
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PDIA3 Antibody 25ul

Anti-PDIA3 Antibody 25ul