RPS6KA3,CLS,HU-3
  • RPS6KA3,CLS,HU-3

Anti-RPS6KA3 Antibody 100ul

Ref: AN-HPA003221-100ul
Anti-RPS6KA3

Información del producto

Polyclonal Antibody against Human RPS6KA3, Gene description: ribosomal protein S6 kinase, 90kDa, polypeptide 3, Alternative Gene Names: CLS, HU-3, MRX19, RSK, RSK2, Validated applications: ICC, IHC, Uniprot ID: P51812, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RPS6KA3
Gene Description ribosomal protein S6 kinase, 90kDa, polypeptide 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence MPLAQLADPWQKMAVESPSDSAENGQQIMDEPMGEEEINPQTEEVSIKEIAITHHVKEGHEKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQLYAMKVLKKATLKVRDRVRTKMERDILVEVNHPFIVKLHYAFQTEGKLY
Immunogen MPLAQLADPWQKMAVESPSDSAENGQQIMDEPMGEEEINPQTEEVSIKEIAITHHVKEGHEKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQLYAMKVLKKATLKVRDRVRTKMERDILVEVNHPFIVKLHYAFQTEGKLY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CLS, HU-3, MRX19, RSK, RSK2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P51812
HTS Code 3002150000
Gene ID 6197
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RPS6KA3 Antibody 100ul

Anti-RPS6KA3 Antibody 100ul