MED15,Arc105,CAG7A
  • MED15,Arc105,CAG7A

Anti-MED15 Antibody 25ul

Ref: AN-HPA003179-25ul
Anti-MED15

Información del producto

Polyclonal Antibody against Human MED15, Gene description: mediator complex subunit 15, Alternative Gene Names: Arc105, CAG7A, PCQAP, TIG-1, TNRC7, Validated applications: ICC, IHC, Uniprot ID: Q96RN5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MED15
Gene Description mediator complex subunit 15
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence QKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQSLTGGPAAGAAGIGMPPRGPGQSLGGMGSLGAMGQPMSLSGQP
Immunogen QKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQSLTGGPAAGAAGIGMPPRGPGQSLGGMGSLGAMGQPMSLSGQP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Arc105, CAG7A, PCQAP, TIG-1, TNRC7
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96RN5
HTS Code 3002150000
Gene ID 51586
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MED15 Antibody 25ul

Anti-MED15 Antibody 25ul