GTPBP1,GP-1,HSPC018
  • GTPBP1,GP-1,HSPC018

Anti-GTPBP1 Antibody 25ul

Ref: AN-HPA003166-25ul
Anti-GTPBP1

Información del producto

Polyclonal Antibody against Human GTPBP1, Gene description: GTP binding protein 1, Alternative Gene Names: GP-1, HSPC018, Validated applications: IHC, Uniprot ID: O00178, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name GTPBP1
Gene Description GTP binding protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LMVGSNAGIVGMTKEHLGLALALNVPVFVVVTKIDMCPANILQETLKLLQRLLKSPGCRKIPVLVQSKDDVIVTASNFSSERMCPIFQISNVTGENLDLLKMFLNLLSPRTSYREEEPAEFQIDDTYSVPGVGTVVSGTTL
Immunogen LMVGSNAGIVGMTKEHLGLALALNVPVFVVVTKIDMCPANILQETLKLLQRLLKSPGCRKIPVLVQSKDDVIVTASNFSSERMCPIFQISNVTGENLDLLKMFLNLLSPRTSYREEEPAEFQIDDTYSVPGVGTVVSGTTL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GP-1, HSPC018
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O00178
HTS Code 3002150000
Gene ID 9567
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-GTPBP1 Antibody 25ul

Anti-GTPBP1 Antibody 25ul