ATP6AP2,APT6M8-9
  • ATP6AP2,APT6M8-9

Anti-ATP6AP2 Antibody 100ul

Ref: AN-HPA003156-100ul
Anti-ATP6AP2

Información del producto

Polyclonal Antibody against Human ATP6AP2, Gene description: ATPase, H+ transporting, lysosomal accessory protein 2, Alternative Gene Names: APT6M8-9, ATP6IP2, ATP6M8-9, M8-9, PRR, RENR, Validated applications: IHC, WB, Uniprot ID: O75787, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ATP6AP2
Gene Description ATPase, H+ transporting, lysosomal accessory protein 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence NSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFN
Immunogen NSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names APT6M8-9, ATP6IP2, ATP6M8-9, M8-9, PRR, RENR
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75787
HTS Code 3002150000
Gene ID 10159
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ATP6AP2 Antibody 100ul

Anti-ATP6AP2 Antibody 100ul