CSDC2,PIPPin
  • CSDC2,PIPPin

Anti-CSDC2 Antibody 100ul

Ref: AN-HPA003073-100ul
Anti-CSDC2

Información del producto

Polyclonal Antibody against Human CSDC2, Gene description: cold shock domain containing C2, RNA binding, Alternative Gene Names: PIPPin, Validated applications: IHC, WB, Uniprot ID: Q9Y534, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CSDC2
Gene Description cold shock domain containing C2, RNA binding
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence PTFPFHREGSRVWERGGVPPRDLPSPLPTKRTRTYSATARASAGPVFKGVCKQFSRSQGHGFITPENGSEDIFVHVSDIEGEYVPVEGDEVTYKMCPIPPKNQ
Immunogen PTFPFHREGSRVWERGGVPPRDLPSPLPTKRTRTYSATARASAGPVFKGVCKQFSRSQGHGFITPENGSEDIFVHVSDIEGEYVPVEGDEVTYKMCPIPPKNQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PIPPin
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y534
HTS Code 3002150000
Gene ID 27254
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CSDC2 Antibody 100ul

Anti-CSDC2 Antibody 100ul