CADM3,BIgR,FLJ10698
  • CADM3,BIgR,FLJ10698

Anti-CADM3 Antibody 100ul

Ref: AN-HPA002981-100ul
Anti-CADM3

Información del producto

Polyclonal Antibody against Human CADM3, Gene description: cell adhesion molecule 3, Alternative Gene Names: BIgR, FLJ10698, IGSF4B, Necl-1, NECL1, SynCAM3, TSLL1, Validated applications: IHC, WB, Uniprot ID: Q8N126, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CADM3
Gene Description cell adhesion molecule 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence QLVTSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQ
Immunogen QLVTSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BIgR, FLJ10698, IGSF4B, Necl-1, NECL1, SynCAM3, TSLL1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N126
HTS Code 3002150000
Gene ID 57863
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CADM3 Antibody 100ul

Anti-CADM3 Antibody 100ul