FBXL12,Fbl12
  • FBXL12,Fbl12

Anti-FBXL12 Antibody 100ul

Ref: AN-HPA002843-100ul
Anti-FBXL12

Información del producto

Polyclonal Antibody against Human FBXL12, Gene description: F-box and leucine-rich repeat protein 12, Alternative Gene Names: Fbl12, FLJ20188, Validated applications: ICC, Uniprot ID: Q9NXK8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FBXL12
Gene Description F-box and leucine-rich repeat protein 12
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence VLGGTYRVTETGLDAGLQELSYLQRLEVLGCTLSADSTLLAISRHLRDVRKIRLTVRGLSAPGLAVLEGMPALESLCLQGPLVTPEMPSPTEILSSCLTMPKLRVLELQGLGWEGQEAEKILCKGLPHCMVIVRAC
Immunogen VLGGTYRVTETGLDAGLQELSYLQRLEVLGCTLSADSTLLAISRHLRDVRKIRLTVRGLSAPGLAVLEGMPALESLCLQGPLVTPEMPSPTEILSSCLTMPKLRVLELQGLGWEGQEAEKILCKGLPHCMVIVRAC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Fbl12, FLJ20188
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NXK8
HTS Code 3002150000
Gene ID 54850
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-FBXL12 Antibody 100ul

Anti-FBXL12 Antibody 100ul